PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_64057.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 274aa    MW: 30076.9 Da    PI: 6.9547
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_64057.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1072.3e-3327754129
           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                   +ekewyfF+++d+ky+tg+r+nrat sgyWkatgkdke+++ +g lvg+kktLvfy grap+gekt Wvmhe+rle
  MLOC_64057.1   2 GEKEWYFFCHKDRKYPTGTRTNRATMSGYWKATGKDKEIFRGRGILVGMKKTLVFYLGRAPRGEKTGWVMHEFRLE 77 
                   578**********************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100538.8791100IPR003441NAC domain
SuperFamilySSF1019412.88E-362100IPR003441NAC domain
PfamPF023651.3E-15676IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGEKEWYFFC HKDRKYPTGT RTNRATMSGY WKATGKDKEI FRGRGILVGM KKTLVFYLGR  60
APRGEKTGWV MHEFRLEGRL PHPLPRSAKD EWAVSKVFNK ELTATNGAMA TAMAAAPDAG  120
IERVSSFGFI SDHFLDAGEL PPLMDPPLGG DVDQVIDFNS NSAYATGGRS GSGLEVKMEQ  180
HMPPHMMYSS PYFSLPAANS GDLSPAIRRY CKAEQVSGQT SALSPSRDTG LSTDPNAAGC  240
AEISSAPTPS SHNQDFLDHL DEYPALNLAD IWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-29110468169NO APICAL MERISTEM PROTEIN
1ut4_B2e-29110468169NO APICAL MERISTEM PROTEIN
1ut7_A2e-29110468169NO APICAL MERISTEM PROTEIN
1ut7_B2e-29110468169NO APICAL MERISTEM PROTEIN
3swm_A2e-29110471172NAC domain-containing protein 19
3swm_B2e-29110471172NAC domain-containing protein 19
3swm_C2e-29110471172NAC domain-containing protein 19
3swm_D2e-29110471172NAC domain-containing protein 19
3swp_A2e-29110471172NAC domain-containing protein 19
3swp_B2e-29110471172NAC domain-containing protein 19
3swp_C2e-29110471172NAC domain-containing protein 19
3swp_D2e-29110471172NAC domain-containing protein 19
4dul_A2e-29110468169NAC domain-containing protein 19
4dul_B2e-29110468169NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197630.0FR819763.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC013 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558001.11e-145PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLR32e-50NAC79_ARATH; NAC domain-containing protein 79
TrEMBLM0XXY20.0M0XXY2_HORVD; Uncharacterized protein
STRINGMLOC_64057.20.0(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.13e-54NAC domain containing protein 46